"FHL3" Related Products

Expand
Expand

Recombinant Human FHL3 Protein, GST-tagged

Cat.No. : FHL3-4163H
Product Overview : Human FHL3 full-length ORF ( AAH01351.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
Description : LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 56.43 kDa
AA Sequence : MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : FHL3 four and a half LIM domains 3 [ Homo sapiens ]
Official Symbol : FHL3
Synonyms : FHL3; four and a half LIM domains 3; four and a half LIM domains protein 3; SLIM2; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2; MGC8696; MGC19547; MGC23614;
Gene ID : 2275
mRNA Refseq : NM_001243878
Protein Refseq : NP_001230807
MIM : 602790
UniProt ID : Q13643

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.