Recombinant Human FHL3 Protein, GST-tagged

Cat.No. : FHL3-4163H
Product Overview : Human FHL3 full-length ORF ( AAH01351.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
Molecular Mass : 56.43 kDa
AA Sequence : MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FHL3 four and a half LIM domains 3 [ Homo sapiens ]
Official Symbol FHL3
Synonyms FHL3; four and a half LIM domains 3; four and a half LIM domains protein 3; SLIM2; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2; MGC8696; MGC19547; MGC23614;
Gene ID 2275
mRNA Refseq NM_001243878
Protein Refseq NP_001230807
MIM 602790
UniProt ID Q13643

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FHL3 Products

Required fields are marked with *

My Review for All FHL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon