Recombinant Human FHL3 Protein, GST-tagged
Cat.No. : | FHL3-4163H |
Product Overview : | Human FHL3 full-length ORF ( AAH01351.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM |
Molecular Mass : | 56.43 kDa |
AA Sequence : | MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FHL3 four and a half LIM domains 3 [ Homo sapiens ] |
Official Symbol | FHL3 |
Synonyms | FHL3; four and a half LIM domains 3; four and a half LIM domains protein 3; SLIM2; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2; MGC8696; MGC19547; MGC23614; |
Gene ID | 2275 |
mRNA Refseq | NM_001243878 |
Protein Refseq | NP_001230807 |
MIM | 602790 |
UniProt ID | Q13643 |
◆ Recombinant Proteins | ||
FHL3-5877M | Recombinant Mouse FHL3 Protein | +Inquiry |
FHL3-2914H | Recombinant Human Four And A half LIM Domains 3, T7-tagged | +Inquiry |
FHL3-12890H | Recombinant Human FHL3, GST-tagged | +Inquiry |
FHL3-4967HF | Recombinant Full Length Human FHL3 Protein, GST-tagged | +Inquiry |
FHL3-1531R | Recombinant Rhesus Macaque FHL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHL3-6222HCL | Recombinant Human FHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHL3 Products
Required fields are marked with *
My Review for All FHL3 Products
Required fields are marked with *