Recombinant Human FHL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FHL3-5365H |
Product Overview : | FHL3 MS Standard C13 and N15-labeled recombinant protein (NP_004459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FHL3 four and a half LIM domains 3 [ Homo sapiens (human) ] |
Official Symbol | FHL3 |
Synonyms | FHL3; four and a half LIM domains 3; four and a half LIM domains protein 3; SLIM2; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2; MGC8696; MGC19547; MGC23614; |
Gene ID | 2275 |
mRNA Refseq | NM_004468 |
Protein Refseq | NP_004459 |
MIM | 602790 |
UniProt ID | Q13643 |
◆ Recombinant Proteins | ||
FHL3-28894TH | Recombinant Human FHL3, His-tagged | +Inquiry |
FHL3-5365H | Recombinant Human FHL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FHL3-12890H | Recombinant Human FHL3, GST-tagged | +Inquiry |
FHL3-5877M | Recombinant Mouse FHL3 Protein | +Inquiry |
FHL3-2914H | Recombinant Human Four And A half LIM Domains 3, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHL3-6222HCL | Recombinant Human FHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHL3 Products
Required fields are marked with *
My Review for All FHL3 Products
Required fields are marked with *