Recombinant Human FHL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FHL3-5365H
Product Overview : FHL3 MS Standard C13 and N15-labeled recombinant protein (NP_004459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 31.2 kDa
AA Sequence : MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FHL3 four and a half LIM domains 3 [ Homo sapiens (human) ]
Official Symbol FHL3
Synonyms FHL3; four and a half LIM domains 3; four and a half LIM domains protein 3; SLIM2; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2; MGC8696; MGC19547; MGC23614;
Gene ID 2275
mRNA Refseq NM_004468
Protein Refseq NP_004459
MIM 602790
UniProt ID Q13643

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FHL3 Products

Required fields are marked with *

My Review for All FHL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon