Recombinant Human FHOD1 Protein, GST-tagged
| Cat.No. : | FHOD1-4166H |
| Product Overview : | Human FHOD1 partial ORF ( NP_037373.1, 2 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which is a member of the formin/diaphanous family of proteins. The gene is ubiquitously expressed but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1 and FH2 domains. It also contains a coiled-coil domain, a collagen-like domain, two nuclear localization signals, and several potential PKC and PKA phosphorylation sites. It is a predominantly cytoplasmic protein and is expressed in a variety of human cell lines. [provided by RefSeq |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FHOD1 formin homology 2 domain containing 1 [ Homo sapiens ] |
| Official Symbol | FHOD1 |
| Synonyms | FHOD1; formin homology 2 domain containing 1; FH1/FH2 domain-containing protein 1; FHOS; formin homolog overexpressed in spleen 1; |
| Gene ID | 29109 |
| mRNA Refseq | NM_013241 |
| Protein Refseq | NP_037373 |
| MIM | 606881 |
| UniProt ID | Q9Y613 |
| ◆ Recombinant Proteins | ||
| FHOD1-2232H | Recombinant Human FHOD1 Protein, MYC/DDK-tagged | +Inquiry |
| FHOD1-3253M | Recombinant Mouse FHOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FHOD1-2003C | Recombinant Chicken FHOD1 | +Inquiry |
| Fhod1-3014M | Recombinant Mouse Fhod1 Protein, Myc/DDK-tagged | +Inquiry |
| FHOD1-4166H | Recombinant Human FHOD1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FHOD1-623HCL | Recombinant Human FHOD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHOD1 Products
Required fields are marked with *
My Review for All FHOD1 Products
Required fields are marked with *
