Recombinant Human FIBIN Protein, GST-tagged
Cat.No. : | FIBIN-4167H |
Product Overview : | Human FIBIN full-length ORF ( NP_976249.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FIBIN (Fin Bud Initiation Factor Homolog (Zebrafish)) is a Protein Coding gene. Diseases associated with FIBIN include Wilson-Turner Syndrome. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FIBIN fin bud initiation factor homolog (zebrafish) [ Homo sapiens (human) ] |
Official Symbol | FIBIN |
Synonyms | FIBIN; fin bud initiation factor homolog (zebrafish); fin bud initiation factor homolog; Fin Bud Initiation Factor Homolog (Zebrafish) |
Gene ID | 387758 |
mRNA Refseq | NM_203371 |
Protein Refseq | NP_976249 |
MIM | 617085 |
UniProt ID | Q8TAL6 |
◆ Recombinant Proteins | ||
FIBIN-1099H | Recombinant Human FIBIN Protein (19-211 aa), His-SUMO-tagged | +Inquiry |
FIBIN-1533R | Recombinant Rhesus Macaque FIBIN Protein, His (Fc)-Avi-tagged | +Inquiry |
FIBIN-3256M | Recombinant Mouse FIBIN Protein, His (Fc)-Avi-tagged | +Inquiry |
Fibin-1288M | Recombinant Mouse Fibin protein, His&Myc-tagged | +Inquiry |
FIBIN-1711R | Recombinant Rhesus monkey FIBIN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIBIN-6220HCL | Recombinant Human FIBIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FIBIN Products
Required fields are marked with *
My Review for All FIBIN Products
Required fields are marked with *
0
Inquiry Basket