Recombinant Human FIBIN Protein, GST-tagged

Cat.No. : FIBIN-4167H
Product Overview : Human FIBIN full-length ORF ( NP_976249.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FIBIN (Fin Bud Initiation Factor Homolog (Zebrafish)) is a Protein Coding gene. Diseases associated with FIBIN include Wilson-Turner Syndrome.
Molecular Mass : 50.7 kDa
AA Sequence : MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FIBIN fin bud initiation factor homolog (zebrafish) [ Homo sapiens (human) ]
Official Symbol FIBIN
Synonyms FIBIN; fin bud initiation factor homolog (zebrafish); fin bud initiation factor homolog; Fin Bud Initiation Factor Homolog (Zebrafish)
Gene ID 387758
mRNA Refseq NM_203371
Protein Refseq NP_976249
MIM 617085
UniProt ID Q8TAL6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FIBIN Products

Required fields are marked with *

My Review for All FIBIN Products

Required fields are marked with *

0
cart-icon
0
compare icon