Recombinant Human FIBIN Protein (19-211 aa), His-SUMO-tagged
Cat.No. : | FIBIN-1099H |
Product Overview : | Recombinant Human FIBIN Protein (19-211 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-211 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.1 kDa |
AA Sequence : | YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | FIBIN fin bud initiation factor homolog [ Homo sapiens (human) ] |
Official Symbol | FIBIN |
Gene ID | 387758 |
mRNA Refseq | NM_203371 |
Protein Refseq | NP_976249 |
UniProt ID | Q8TAL6 |
◆ Recombinant Proteins | ||
FIBIN-4167H | Recombinant Human FIBIN Protein, GST-tagged | +Inquiry |
FIBIN-4977HF | Recombinant Full Length Human FIBIN Protein, GST-tagged | +Inquiry |
FIBIN-3014H | Recombinant Human FIBIN protein, His-tagged | +Inquiry |
FIBIN-1099H | Recombinant Human FIBIN Protein (19-211 aa), His-SUMO-tagged | +Inquiry |
fibin-1199Z | Recombinant Zebrafish fibin protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIBIN-6220HCL | Recombinant Human FIBIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FIBIN Products
Required fields are marked with *
My Review for All FIBIN Products
Required fields are marked with *
0
Inquiry Basket