Recombinant Human FIBP protein, GST-tagged
| Cat.No. : | FIBP-7822H |
| Product Overview : | Recombinant Human FIBP protein(1-357 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-357 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ] |
| Official Symbol | FIBP |
| Synonyms | FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1; |
| mRNA Refseq | NM_004214 |
| Protein Refseq | NP_004205 |
| MIM | 608296 |
| UniProt ID | O43427 |
| Gene ID | 9158 |
| ◆ Recombinant Proteins | ||
| FIBP-3257H | Recombinant Human FIBP Protein (Met1-Asp357) | +Inquiry |
| FIBP-3258H | Recombinant Human FIBP Protein (Leu14-Val215), N-His tagged | +Inquiry |
| FIBP-7822H | Recombinant Human FIBP protein, GST-tagged | +Inquiry |
| FIBP-4168H | Recombinant Human FIBP Protein, GST-tagged | +Inquiry |
| FIBP-2919H | Recombinant Human FIBP protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIBP Products
Required fields are marked with *
My Review for All FIBP Products
Required fields are marked with *
