Recombinant Human FIBP Protein, GST-tagged
Cat.No. : | FIBP-4168H |
Product Overview : | Human FIBP full-length ORF ( AAH14388, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 65.01 kDa |
AA Sequence : | MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVGDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ] |
Official Symbol | FIBP |
Synonyms | FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1; |
Gene ID | 9158 |
mRNA Refseq | NM_004214 |
Protein Refseq | NP_004205 |
MIM | 608296 |
UniProt ID | O43427 |
◆ Recombinant Proteins | ||
FIBP-12893H | Recombinant Human FIBP protein, His-tagged | +Inquiry |
FIBP-4980HF | Recombinant Full Length Human FIBP Protein, GST-tagged | +Inquiry |
FIBP-99H | Recombinant Human FIBP | +Inquiry |
FIBP-7822H | Recombinant Human FIBP protein, GST-tagged | +Inquiry |
FIBP-3257H | Recombinant Human FIBP Protein (Met1-Asp357) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FIBP Products
Required fields are marked with *
My Review for All FIBP Products
Required fields are marked with *
0
Inquiry Basket