Recombinant Human FIBP Protein, GST-tagged

Cat.No. : FIBP-4168H
Product Overview : Human FIBP full-length ORF ( AAH14388, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 65.01 kDa
AA Sequence : MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVGDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ]
Official Symbol FIBP
Synonyms FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1;
Gene ID 9158
mRNA Refseq NM_004214
Protein Refseq NP_004205
MIM 608296
UniProt ID O43427

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FIBP Products

Required fields are marked with *

My Review for All FIBP Products

Required fields are marked with *

0
cart-icon