Recombinant Human Fibronectin III 8-10, 13, GST-tagged
Cat.No. : | FN1-107H |
Product Overview : | This recombinant FN fragment corresponds to amino acids 1235-1509 of type-III 8-10, joined to 1782-1870 of type-III 13 by an ID linker This fragment contains the complete itegrin binding region of the peptide, required for cell binding and adhesion, as well as the C-terminal heprin binding domain region. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1235-1509 a.a. |
Description : | Fibronectins (FN) are a family of high molecular weight, multidomain glycoproteins composed of two structurally similar subunits which are joined at the carboxyl terminus by disulfide bonds. The primary structure of FN is organized into three types of repeating homologous units, termed types I, II, and III. These modules in turn are organized into functional domains which have been shown to contain multiple binding sites, including those for sulfated glycosaminoglycans, gelatin, fibrin, and cell surface integrin receptors. Twelve type I modules are found grouped at the amino- and carboxyl-terminal regions, and two type II modules are located within the gelatin-binding region. Fifteen to seventeen type III modules are contained within the middle of the molecule and comprise 60% of fibronectin’s sequence. |
Molecular Mass : | 66364.3 Da |
AA Sequence : | AVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSS VYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITL TNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSP VQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT*ID*NVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST |
Purity : | > 90% by SDS-PAGE |
Storage : | Store at -80°C |
Concentration : | 4.0 mg/ml |
Storage Buffer : | Solution in PBS |
Shipping : | Dry Ice |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
Chromosome Location | 2q34 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; |
Function | collagen binding; extracellular matrix structural constituent; heparin binding; protein binding; |
◆ Recombinant Proteins | ||
FN1-46H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-2176H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
FN1-107H | Recombinant Human Fibronectin III 8-10, 13, GST-tagged | +Inquiry |
FN1-5000HF | Recombinant Full Length Human FN1 Protein, GST-tagged | +Inquiry |
FN1-632B | Recombinant Bovine FN1 protein(53-273aa), His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *