Recombinant Human FKBP14, His-tagged

• Cat.No.: FKBP14-28911TH
• Product Overview: Recombinant full length Human FKBP14 with an N terminal His tag; 213 amino acids with tag, MWt 24.2 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 192 amino acids
• Description: FKBP14, also known as 22 kDa FK506-binding protein, is an enzyme that accelerates the folding of proteins during protein synthesis. This protein contains two EF-hand domains and one PPIase FKBP-type domain.
• Conjugation: HIS
• Molecular Weight: 24.200kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
• Sequence Similarities: Contains 2 EF-hand domains.Contains 1 PPIase FKBP-type domain.

Gene Information

• Gene Name: FKBP14 FK506 binding protein 14, 22 kDa [ Homo sapiens ]
• Official Symbol: FKBP14
• Synonyms: FKBP14; FK506 binding protein 14, 22 kDa; FK506 binding protein 14 (22 kDa); peptidyl-prolyl cis-trans isomerase FKBP14; FKBP22; FLJ20731
• Gene ID: 55033
• mRNA Refseq: NM_017946
• Protein Refseq: NP_060416
• Uniprot ID: Q9NWM8
• Chromosome Location: 7p15
• Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Unfolded Protein Response, organism-specific biosystem
• Function: FK506 binding; calcium ion binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity