Recombinant Human FKBP1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FKBP1A-1987H |
Product Overview : | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_000792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. |
Molecular Mass : | 12 kDa |
AA Sequence : | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FKBP1A FKBP prolyl isomerase 1A [ Homo sapiens (human) ] |
Official Symbol | FKBP1A |
Synonyms | FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD), FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A; |
Gene ID | 2280 |
mRNA Refseq | NM_000801 |
Protein Refseq | NP_000792 |
MIM | 186945 |
UniProt ID | P62942 |
◆ Recombinant Proteins | ||
Fkbp1a-64M | Recombinant Mouse Fkbp1a, His-tagged | +Inquiry |
FKBP1A-1265C | Recombinant Cattle FKBP1A protein, His-tagged | +Inquiry |
FKBP1A-1987H | Recombinant Human FKBP1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FKBP1A-7485H | Recombinant Human FKBP1A protein, His-tagged | +Inquiry |
FKBP1A-2529H | Recombinant Human FKBP1A Protein (Gly2-Glu108), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1A Products
Required fields are marked with *
My Review for All FKBP1A Products
Required fields are marked with *