Recombinant Human FKBP2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | FKBP2-343H |
Product Overview : | FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004461) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008] |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MRLSWFQVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FKBP2 FK506 binding protein 2, 13kDa [ Homo sapiens (human) ] |
Official Symbol | FKBP2 |
Synonyms | FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13; |
Gene ID | 2286 |
mRNA Refseq | NM_004470 |
Protein Refseq | NP_004461 |
MIM | 186946 |
UniProt ID | P26885 |
◆ Recombinant Proteins | ||
Fkbp2-3025M | Recombinant Mouse Fkbp2 Protein, Myc/DDK-tagged | +Inquiry |
FKBP2-1288H | Active Recombinant Human FK506 Binding Protein 2, 13kDa | +Inquiry |
FKBP2-734H | Recombinant Human FKBP2 Protein, His-tagged | +Inquiry |
FKBP2-1385Z | Recombinant Zebrafish FKBP2 | +Inquiry |
FKBP2-3477H | Recombinant Human FKBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP2 Products
Required fields are marked with *
My Review for All FKBP2 Products
Required fields are marked with *
0
Inquiry Basket