Recombinant Human FKBP3, His-tagged

Cat.No. : FKBP3-28917TH
Product Overview : Recombinant fragment, corresponding to amino acids 49-224 of Human FKBP25 with an N-terminal His tag; Predicted MWt 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 49-224 a.a.
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNV KLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPK KGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSF KVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKG QPDAKIPPNAKLTFEVELVDID
Gene Name FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol FKBP3
Synonyms FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase;
Gene ID 2287
mRNA Refseq NM_002013
Protein Refseq NP_002004
MIM 186947
Uniprot ID Q00688
Chromosome Location 14q21.2
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP3 Products

Required fields are marked with *

My Review for All FKBP3 Products

Required fields are marked with *

0
cart-icon