Recombinant Human FKBP3, His-tagged
Cat.No. : | FKBP3-28917TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 49-224 of Human FKBP25 with an N-terminal His tag; Predicted MWt 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 49-224 a.a. |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNV KLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPK KGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSF KVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKG QPDAKIPPNAKLTFEVELVDID |
Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
Official Symbol | FKBP3 |
Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; |
Gene ID | 2287 |
mRNA Refseq | NM_002013 |
Protein Refseq | NP_002004 |
MIM | 186947 |
Uniprot ID | Q00688 |
Chromosome Location | 14q21.2 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity; |
◆ Recombinant Proteins | ||
FKBP3-2026H | Recombinant Human FK506 Binding Protein 3, 25kDa | +Inquiry |
FKBP3-4804HF | Recombinant Full Length Human FKBP3 Protein, GST-tagged | +Inquiry |
FKBP3-6209C | Recombinant Chicken FKBP3 | +Inquiry |
FKBP3-9658H | Recombinant Human FKBP3 protein, His-tagged | +Inquiry |
FKBP3-373H | Recombinant Human FKBP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *