Recombinant Human FKBP3 protein, His-SUMO-tagged
Cat.No. : | FKBP3-2921H |
Product Overview : | Recombinant Human FKBP3 protein(Q00688)(2-224aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-224aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41 kDa |
AA Sequence : | AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
Official Symbol | FKBP3 |
Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25; |
Gene ID | 2287 |
mRNA Refseq | NM_002013 |
Protein Refseq | NP_002004 |
MIM | 186947 |
UniProt ID | Q00688 |
◆ Recombinant Proteins | ||
FKBP3-9658H | Recombinant Human FKBP3 protein, His-tagged | +Inquiry |
Fkbp3-3026M | Recombinant Mouse Fkbp3 Protein, Myc/DDK-tagged | +Inquiry |
FKBP3-1251Z | Recombinant Zebrafish FKBP3 | +Inquiry |
FKBP3-2921H | Recombinant Human FKBP3 protein, His-SUMO-tagged | +Inquiry |
FKBP3-4804HF | Recombinant Full Length Human FKBP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *
0
Inquiry Basket