Recombinant Human FKBP7 Protein, GST-tagged
Cat.No. : | FKBP7-4196H |
Product Overview : | Human FKBP7 full-length ORF ( AAH09711.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq |
Molecular Mass : | 50.05 kDa |
AA Sequence : | MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP7 FK506 binding protein 7 [ Homo sapiens ] |
Official Symbol | FKBP7 |
Synonyms | FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420; |
Gene ID | 51661 |
mRNA Refseq | NM_001135212 |
Protein Refseq | NP_001128684 |
MIM | 607062 |
UniProt ID | Q9Y680 |
◆ Recombinant Proteins | ||
FKBP7-2753H | Recombinant Human FKBP7 Protein (Gln24-Leu222), C-His tagged | +Inquiry |
FKBP7-1285H | Recombinant Human FKBP7 protein, His & T7-tagged | +Inquiry |
FKBP7-8566H | Recombinant Human FKBP7 protein, His-tagged | +Inquiry |
FKBP7-4816HF | Recombinant Full Length Human FKBP7 Protein, GST-tagged | +Inquiry |
FKBP7-8565H | Recombinant Human FKBP7, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP7-1314HCL | Recombinant Human FKBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP7 Products
Required fields are marked with *
My Review for All FKBP7 Products
Required fields are marked with *