Recombinant Human FKBP7 Protein, GST-tagged

Cat.No. : FKBP7-4196H
Product Overview : Human FKBP7 full-length ORF ( AAH09711.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq
Molecular Mass : 50.05 kDa
AA Sequence : MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP7 FK506 binding protein 7 [ Homo sapiens ]
Official Symbol FKBP7
Synonyms FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420;
Gene ID 51661
mRNA Refseq NM_001135212
Protein Refseq NP_001128684
MIM 607062
UniProt ID Q9Y680

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP7 Products

Required fields are marked with *

My Review for All FKBP7 Products

Required fields are marked with *

0
cart-icon