Recombinant Human FKBP8 Protein, GST-tagged
Cat.No. : | FKBP8-4198H |
Product Overview : | Human FKBP8 full-length ORF ( AAH09966, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. [provided by RefSeq |
Molecular Mass : | 64.79 kDa |
AA Sequence : | MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGPVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRRRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP8 FK506 binding protein 8, 38kDa [ Homo sapiens ] |
Official Symbol | FKBP8 |
Synonyms | FKBP8; FK506 binding protein 8, 38kDa; FK506 binding protein 8 (38kD); peptidyl-prolyl cis-trans isomerase FKBP8; FKBP38; FKBPr38; FKBP-8; FKBP-38; hFKBP38; rotamase; 38 kDa FKBP; PPIase FKBP8; 38 kDa FK506-binding protein; FK506-binding protein 8 (38kD); |
Gene ID | 23770 |
mRNA Refseq | NM_012181 |
Protein Refseq | NP_036313 |
MIM | 604840 |
UniProt ID | Q14318 |
◆ Recombinant Proteins | ||
RFL9078RF | Recombinant Full Length Rat Peptidyl-Prolyl Cis-Trans Isomerase Fkbp8(Fkbp8) Protein, His-Tagged | +Inquiry |
FKBP8-2357R | Recombinant Rat FKBP8 Protein | +Inquiry |
FKBP8-1544R | Recombinant Rhesus Macaque FKBP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP8-4818HF | Recombinant Full Length Human FKBP8 Protein, GST-tagged | +Inquiry |
FKBP8-2013R | Recombinant Rat FKBP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP8-6202HCL | Recombinant Human FKBP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP8 Products
Required fields are marked with *
My Review for All FKBP8 Products
Required fields are marked with *