Recombinant Human FKTN Protein, GST-tagged
Cat.No. : | FKTN-4016H |
Product Overview : | Human FCMD partial ORF ( NP_006722, 29 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a putative transmembrane protein that is localized to the cis-Golgi compartment, where it may be involved in the glycosylation of alpha-dystroglycan in skeletal muscle. The encoded protein is thought to be a glycosyltransferase and could play a role in brain development. Defects in this gene are a cause of Fukuyama-type congenital muscular dystrophy (FCMD), Walker-Warburg syndrome (WWS), limb-girdle muscular dystrophy type 2M (LGMD2M), and dilated cardiomyopathy type 1X (CMD1X). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | KHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKTN fukutin [ Homo sapiens ] |
Official Symbol | FKTN |
Synonyms | FKTN; fukutin; FCMD, Fukuyama type congenital muscular dystrophy (fukutin); LGMD2M; patient fukutin; Fukuyama type congenital muscular dystrophy protein; FCMD; CMD1X; MDDGA4; MDDGB4; MDDGC4; MGC126857; MGC134944; MGC134945; MGC138243; |
Gene ID | 2218 |
mRNA Refseq | NM_001079802 |
Protein Refseq | NP_001073270 |
MIM | 607440 |
UniProt ID | O75072 |
◆ Recombinant Proteins | ||
FKTN-962H | Recombinant Human FKTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FKTN-12921H | Recombinant Human FKTN, His-tagged | +Inquiry |
FKTN-948H | Recombinant Human FKTN Full Length Transmembrane protein, His-tagged | +Inquiry |
FKTN-3822Z | Recombinant Zebrafish FKTN | +Inquiry |
Fktn-3034M | Recombinant Mouse Fktn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKTN-6198HCL | Recombinant Human FKTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKTN Products
Required fields are marked with *
My Review for All FKTN Products
Required fields are marked with *