Recombinant Human FLG protein(2441-2620 aa), C-His-tagged
| Cat.No. : | FLG-2692H | 
| Product Overview : | Recombinant Human FLG protein(P20930)(2441-2620 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 2441-2620 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | SHHKQARDSSRHSTSQEGQDTIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRNDEQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSA | 
| Gene Name | FLG filaggrin [ Homo sapiens ] | 
| Official Symbol | FLG | 
| Synonyms | FLG; filaggrin; epidermal filaggrin; ATOD2; | 
| Gene ID | 2312 | 
| mRNA Refseq | NM_002016 | 
| Protein Refseq | NP_002007 | 
| MIM | 135940 | 
| UniProt ID | P20930 | 
| ◆ Recombinant Proteins | ||
| FLG-1220H | Recombinant Human Filaggrin | +Inquiry | 
| FLG-1503H | Recombinant Human FLG Protein, His&GST-tagged | +Inquiry | 
| FLG-3361M | Recombinant Mouse FLG protein, His-tagged | +Inquiry | 
| FLG-2217H | Recombinant Human FLG protein, His-tagged | +Inquiry | 
| FLG-4554H | Recombinant Human FLG protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLG Products
Required fields are marked with *
My Review for All FLG Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            