Recombinant Human FLG protein(2441-2620 aa), C-His-tagged

• Cat.No.: FLG-2692H
• Product Overview: Recombinant Human FLG protein(P20930)(2441-2620 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2441-2620 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SHHKQARDSSRHSTSQEGQDTIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRNDEQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSA

Gene Information

• Gene Name: FLG filaggrin [ Homo sapiens ]
• Official Symbol: FLG
• Synonyms: FLG; filaggrin; epidermal filaggrin; ATOD2
• Gene ID: 2312
• mRNA Refseq: NM_002016
• Protein Refseq: NP_002007
• MIM: 135940
• UniProt ID: P20930