Recombinant Human Fli-1 proto-oncogene, ETS transcription factor Protein, His-tagged

Cat.No. : FLI1-001H
Product Overview : Recombinant human Fli-1 proto-oncogene, ETS transcription factor Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 13-112aa
Description : This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants.
Tag : C-His
Molecular Mass : 12 kDa
AA Sequence : MSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPHHHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : 1 mg/mL by BCA
Gene Name FLI1 Fli-1 proto-oncogene, ETS transcription factor [ Homo sapiens (human) ]
Official Symbol FLI1
Synonyms FLI1; Friend leukemia virus integration 1; Friend leukemia integration 1 transcription factor; EWSR2; SIC 1; proto-oncogene Fli-1; transcription factor ERGB; SIC-1;
Gene ID 2313
mRNA Refseq NM_001167681
Protein Refseq NP_001161153
MIM 193067
UniProt ID Q01543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLI1 Products

Required fields are marked with *

My Review for All FLI1 Products

Required fields are marked with *

0
cart-icon
0
compare icon