Recombinant Human Fli-1 proto-oncogene, ETS transcription factor Protein, His-tagged

• Cat.No.: FLI1-001H
• Product Overview: Recombinant human Fli-1 proto-oncogene, ETS transcription factor Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 13-112aa
• Description: This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants.
• Tag: C-His
• Molecular Mass: 12 kDa
• AA Sequence: MSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPHHHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: FLI1 Fli-1 proto-oncogene, ETS transcription factor [ Homo sapiens (human) ]
• Official Symbol: FLI1
• Synonyms: FLI1; Friend leukemia virus integration 1; Friend leukemia integration 1 transcription factor; EWSR2; SIC 1; proto-oncogene Fli-1; transcription factor ERGB; SIC-1
• Gene ID: 2313
• mRNA Refseq: NM_001167681
• Protein Refseq: NP_001161153
• MIM: 193067
• UniProt ID: Q01543