Recombinant Human FLNB Protein, GST-tagged

Cat.No. : FLNB-4358H
Product Overview : Human FLNB partial ORF ( NP_001448, 2503 a.a. - 2602 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the filamin family. The encoded protein interacts with glycoprotein Ib alpha as part of the process to repair vascular injuries. The platelet glycoprotein Ib complex includes glycoprotein Ib alpha, and it binds the actin cytoskeleton. Mutations in this gene have been found in several conditions: atelosteogenesis type 1 and type 3; boomerang dysplasia; autosomal dominant Larsen syndrome; and spondylocarpotarsal synostosis syndrome. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Nov 2009]
Molecular Mass : 36.74 kDa
AA Sequence : SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLNB filamin B, beta [ Homo sapiens ]
Official Symbol FLNB
Synonyms FLNB; filamin B, beta; filamin B, beta (actin binding protein 278), FLN1L, Larsen syndrome 1 (autosomal dominant), LRS1; filamin-B; ABP 278; actin binding protein 278; FH1; TABP; TAP; filamin-3; beta-filamin; ABP-280 homolog; filamin homolog 1; thyroid autoantigen; actin-binding-like protein; Larsen syndrome 1 (autosomal dominant); AOI; SCT; LRS1; FLN-B; FLN1L; ABP-278; ABP-280; DKFZp686O033; DKFZp686A1668;
Gene ID 2317
mRNA Refseq NM_001164317
Protein Refseq NP_001157789
MIM 603381
UniProt ID O75369

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLNB Products

Required fields are marked with *

My Review for All FLNB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon