Recombinant Human FLNB Protein, GST-tagged
Cat.No. : | FLNB-4358H |
Product Overview : | Human FLNB partial ORF ( NP_001448, 2503 a.a. - 2602 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the filamin family. The encoded protein interacts with glycoprotein Ib alpha as part of the process to repair vascular injuries. The platelet glycoprotein Ib complex includes glycoprotein Ib alpha, and it binds the actin cytoskeleton. Mutations in this gene have been found in several conditions: atelosteogenesis type 1 and type 3; boomerang dysplasia; autosomal dominant Larsen syndrome; and spondylocarpotarsal synostosis syndrome. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLNB filamin B, beta [ Homo sapiens ] |
Official Symbol | FLNB |
Synonyms | FLNB; filamin B, beta; filamin B, beta (actin binding protein 278), FLN1L, Larsen syndrome 1 (autosomal dominant), LRS1; filamin-B; ABP 278; actin binding protein 278; FH1; TABP; TAP; filamin-3; beta-filamin; ABP-280 homolog; filamin homolog 1; thyroid autoantigen; actin-binding-like protein; Larsen syndrome 1 (autosomal dominant); AOI; SCT; LRS1; FLN-B; FLN1L; ABP-278; ABP-280; DKFZp686O033; DKFZp686A1668; |
Gene ID | 2317 |
mRNA Refseq | NM_001164317 |
Protein Refseq | NP_001157789 |
MIM | 603381 |
UniProt ID | O75369 |
◆ Recombinant Proteins | ||
FLNB-1387H | Recombinant Human FLNB protein, His-tagged | +Inquiry |
FLNB-1388H | Recombinant Human FLNB protein, His & T7-tagged | +Inquiry |
FLNB-1389H | Recombinant Human FLNB protein, His-tagged | +Inquiry |
FLNB-2227C | Recombinant Chicken FLNB | +Inquiry |
FLNB-4358H | Recombinant Human FLNB Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNB Products
Required fields are marked with *
My Review for All FLNB Products
Required fields are marked with *