Recombinant human FLT3, Active

Cat.No. : FLT3-1550H
Product Overview : Recombinant human FLt3 is a polypeptide chain containing 165 amino acids (27–181 of P49771-1 FLT3L_HUMAN). It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Protein Length : 27-181 a.a.
Description : FLt3 ligand is a transmembrane glycoprotein that activates the FLt3 receptor (CD135, FLK2). FLT3 ligand, in synergy with other cytokines, stimulates the growth and differentiation of a number of important cell populations. Activation of FLt3 stimulates the growth and differentiation of very early stem cells involved in haematopoiesis, myelopoiesis, erythropoiesis and megakaryopoiesis. FLt3 activation mobilizes hematopoietic progenitor cells into peripheral blood and induces proliferation of myeloid and dendritic cells (DC). Dysregulation of FLt3 has been associated with acute leukaemia(s) involving myeloid (AML), T, and B blast cell(s).
Form : Recombinant human Flt3 is lyophilized from a Tris HCl 0.05M buffer pH 7.4.
Molecular Mass : 18.4 kDa, apparent molecular mass of 18-25 kDa in SDS-PAGE.
AA Sequence : HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA
Endotoxin : < 0.04="" eu/μg="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Storage : This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution : Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines.
Gene Name FLT3 fms-related tyrosine kinase 3 [ Homo sapiens ]
Official Symbol FLT3
Synonyms FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1; STK-1; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III; FLK-2;
Gene ID 2322
mRNA Refseq NM_004119
Protein Refseq NP_004110
MIM 136351
UniProt ID P36888
Chromosome Location 13q12
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function ATP binding; cytokine receptor activity; nucleotide binding; phosphatidylinositol 3-kinase binding; protein homodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kina

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3 Products

Required fields are marked with *

My Review for All FLT3 Products

Required fields are marked with *

0
cart-icon