Recombinant Human FLT3 Protein, GST-tagged
Cat.No. : | FLT3-4371H |
Product Overview : | Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLT3 fms-related tyrosine kinase 3 [ Homo sapiens ] |
Official Symbol | FLT3 |
Synonyms | FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1; STK-1; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III; FLK-2; |
Gene ID | 2322 |
mRNA Refseq | NM_004119 |
Protein Refseq | NP_004110 |
MIM | 136351 |
UniProt ID | P36888 |
◆ Recombinant Proteins | ||
FLT3-1569R | Recombinant Rhesus Monkey FLT3 Protein, hIgG4-tagged | +Inquiry |
Flt3-500M | Recombinant Mouse FMS-like Tyrosine Kinase 3 | +Inquiry |
FLT3-6334H | Recombinant Human FLT3 protein, His-tagged | +Inquiry |
FLT3-4902H | Active Recombinant Human FLT3 protein, GST/His-tagged | +Inquiry |
FLT3-688H | Recombinant Human FLT3, GST-His | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3-2561HCL | Recombinant Human FLT3 cell lysate | +Inquiry |
FLT3-970MCL | Recombinant Mouse FLT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3 Products
Required fields are marked with *
My Review for All FLT3 Products
Required fields are marked with *
0
Inquiry Basket