Recombinant Human FMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FMC1-1836H
• Product Overview: C7orf55 MS Standard C13 and N15-labeled recombinant protein (NP_932068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V).
• Molecular Mass: 12.7 kDa
• AA Sequence: MAALGSPAHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FMC1 formation of mitochondrial complex V assembly factor 1 homolog [ Homo sapiens (human) ]
• Official Symbol: FMC1
• Synonyms: FMC1; formation of mitochondrial complex V assembly factor 1 homolog; C7orf55; HSPC268; protein FMC1 homolog; ATP synthase assembly factor FMC1, mitochondrial; UPF0562 protein C7orf55; formation of mitochondrial complexes 1 homolog
• Gene ID: 154791
• mRNA Refseq: NM_197964
• Protein Refseq: NP_932068
• UniProt ID: Q96HJ9