Recombinant Human FMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FMC1-1836H |
Product Overview : | C7orf55 MS Standard C13 and N15-labeled recombinant protein (NP_932068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V). |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MAALGSPAHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FMC1 formation of mitochondrial complex V assembly factor 1 homolog [ Homo sapiens (human) ] |
Official Symbol | FMC1 |
Synonyms | FMC1; formation of mitochondrial complex V assembly factor 1 homolog; C7orf55; HSPC268; protein FMC1 homolog; ATP synthase assembly factor FMC1, mitochondrial; UPF0562 protein C7orf55; formation of mitochondrial complexes 1 homolog |
Gene ID | 154791 |
mRNA Refseq | NM_197964 |
Protein Refseq | NP_932068 |
UniProt ID | Q96HJ9 |
◆ Recombinant Proteins | ||
FMC1-2366R | Recombinant Rat FMC1 Protein | +Inquiry |
FMC1-2434H | Recombinant Human FMC1 Protein, MYC/DDK-tagged | +Inquiry |
FMC1-1836H | Recombinant Human FMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fmc1-3049M | Recombinant Mouse Fmc1 Protein, Myc/DDK-tagged | +Inquiry |
FMC1-2022R | Recombinant Rat FMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMC1 Products
Required fields are marked with *
My Review for All FMC1 Products
Required fields are marked with *