Recombinant Human FMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FMC1-1836H
Product Overview : C7orf55 MS Standard C13 and N15-labeled recombinant protein (NP_932068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V).
Molecular Mass : 12.7 kDa
AA Sequence : MAALGSPAHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FMC1 formation of mitochondrial complex V assembly factor 1 homolog [ Homo sapiens (human) ]
Official Symbol FMC1
Synonyms FMC1; formation of mitochondrial complex V assembly factor 1 homolog; C7orf55; HSPC268; protein FMC1 homolog; ATP synthase assembly factor FMC1, mitochondrial; UPF0562 protein C7orf55; formation of mitochondrial complexes 1 homolog
Gene ID 154791
mRNA Refseq NM_197964
Protein Refseq NP_932068
UniProt ID Q96HJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FMC1 Products

Required fields are marked with *

My Review for All FMC1 Products

Required fields are marked with *

0
cart-icon