Recombinant Human FMN2 Protein, GST-tagged

• Cat.No.: FMN2-4387H
• Product Overview: Human FMN2 partial ORF ( AAH14364.2, 144 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Formin homology (FH) domain proteins (e.g., FMN; MIM 136535) play a role in cytoskeletal organization and/or establishment of cell polarity.[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FMN2 formin 2 [ Homo sapiens ]
• Official Symbol: FMN2
• Synonyms: FMN2; formin 2; formin-2
• Gene ID: 56776
• mRNA Refseq: NM_020066
• Protein Refseq: NP_064450
• MIM: 606373
• UniProt ID: Q9NZ56