Recombinant Human FMN2 Protein, GST-tagged
Cat.No. : | FMN2-4387H |
Product Overview : | Human FMN2 partial ORF ( AAH14364.2, 144 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Formin homology (FH) domain proteins (e.g., FMN; MIM 136535) play a role in cytoskeletal organization and/or establishment of cell polarity.[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FMN2 formin 2 [ Homo sapiens ] |
Official Symbol | FMN2 |
Synonyms | FMN2; formin 2; formin-2; |
Gene ID | 56776 |
mRNA Refseq | NM_020066 |
Protein Refseq | NP_064450 |
MIM | 606373 |
UniProt ID | Q9NZ56 |
◆ Recombinant Proteins | ||
FMN2-4387H | Recombinant Human FMN2 Protein, GST-tagged | +Inquiry |
FMN2-5934M | Recombinant Mouse FMN2 Protein | +Inquiry |
FMN2-3286M | Recombinant Mouse FMN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FMN2-3631H | Recombinant Human FMN2 protein, His-tagged | +Inquiry |
FMN2-7876H | Recombinant Human FMN2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMN2 Products
Required fields are marked with *
My Review for All FMN2 Products
Required fields are marked with *
0
Inquiry Basket