Recombinant Human FMNL3 protein, GST-tagged
| Cat.No. : | FMNL3-5744H |
| Product Overview : | Recombinant Human FMNL3 protein(403-510 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 403-510 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FMNL3 formin-like 3 [ Homo sapiens ] |
| Official Symbol | FMNL3 |
| Synonyms | FMNL3; formin-like 3; formin-like protein 3; DKFZp762B245; MGC45819; WBP3; WW domain binding protein 3; WW domain-binding protein 3; formin homology 2 domain-containing protein 3; FHOD3; WBP-3; FLJ45265; |
| Gene ID | 91010 |
| mRNA Refseq | NM_175736 |
| Protein Refseq | NP_783863 |
| UniProt ID | Q8IVF7 |
| ◆ Recombinant Proteins | ||
| FMNL3-5745H | Recombinant Human FMNL3 protein, His-tagged | +Inquiry |
| FMNL3-5744H | Recombinant Human FMNL3 protein, GST-tagged | +Inquiry |
| FMNL3-2435H | Recombinant Human FMNL3 Protein, MYC/DDK-tagged | +Inquiry |
| FMNL3-4986HF | Recombinant Full Length Human FMNL3 Protein, GST-tagged | +Inquiry |
| FMNL3-4391H | Recombinant Human FMNL3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FMNL3-659HCL | Recombinant Human FMNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMNL3 Products
Required fields are marked with *
My Review for All FMNL3 Products
Required fields are marked with *
