Recombinant Human FMO4 Protein, GST-tagged

Cat.No. : FMO4-4393H
Product Overview : Human FMO4 partial ORF ( NP_002013.1, 206 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq
Molecular Mass : 36.3 kDa
AA Sequence : TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FMO4 flavin containing monooxygenase 4 [ Homo sapiens ]
Official Symbol FMO4
Synonyms FMO4; flavin containing monooxygenase 4; FMO2; dimethylaniline monooxygenase [N-oxide-forming] 4; FMO 4; dimethylaniline oxidase 4; hepatic flavin-containing monooxygenase 4;
Gene ID 2329
mRNA Refseq NM_002022
Protein Refseq NP_002013
MIM 136131
UniProt ID P31512

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FMO4 Products

Required fields are marked with *

My Review for All FMO4 Products

Required fields are marked with *

0
cart-icon
0
compare icon