Recombinant Human FN1 protein, His-tagged
Cat.No. : | FN1-4258H |
Product Overview : | Recombinant Human FN1 protein(P02751)(732-911aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 732-911aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.6 kDa |
AA Sequence : | TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
◆ Recombinant Proteins | ||
FN1-710H | Recombinant Human FN1(Glu1266-Thr1356) Protein, N-Avi-6*His-tagged, Biotinylated | +Inquiry |
FN1-5947M | Recombinant Mouse FN1 Protein | +Inquiry |
FN1-46H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-4210C | Recombinant Chicken FN1 | +Inquiry |
FN1-632B | Recombinant Bovine FN1 protein(53-273aa), His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
0
Inquiry Basket