Recombinant Human FN1 protein, His-tagged
| Cat.No. : | FN1-4258H |
| Product Overview : | Recombinant Human FN1 protein(P02751)(732-911aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 732-911aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.6 kDa |
| AA Sequence : | TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
| Official Symbol | FN1 |
| Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
| Gene ID | 2335 |
| mRNA Refseq | NM_002026 |
| Protein Refseq | NP_002017 |
| MIM | 135600 |
| UniProt ID | P02751 |
| ◆ Recombinant Proteins | ||
| FN1-1384H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
| FN1-882H | Active Recombinant Human FN1 Protein, His-tagged | +Inquiry |
| FN1-1811H | Recombinant Human FN1 protein, GST-tagged | +Inquiry |
| FN1-33H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
| FN1-3296M | Recombinant Mouse FN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| FN1-700H | Native Human Fibronectin 1 | +Inquiry |
| Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
| FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
| FN1-701H | Native Human Fibronectin 1 | +Inquiry |
| FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FN1-166HKCL | Human FN1 Knockdown Cell Lysate | +Inquiry |
| FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
