Recombinant Human FNBP1L Protein, GST-tagged
Cat.No. : | FNBP1L-4405H |
Product Overview : | Human FNBP1L partial ORF ( NP_060207.2, 175 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 32.89 kDa |
AA Sequence : | LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FNBP1L formin binding protein 1-like [ Homo sapiens ] |
Official Symbol | FNBP1L |
Synonyms | FNBP1L; formin binding protein 1-like; TOCA1; C1orf39; Formin Binding Protein 1 Like; Transducer Of Cdc42-Dependent Actin Assembly Protein 1; C1orf39; Toca-1; TOCA1; Transducer Of Cdc42-Dependent Actin Assembly 1; Chromosome 1 Open Reading Frame 39; Formin Binding Protein 1-Like; Formin-Binding Protein 1-Like |
Gene ID | 54874 |
mRNA Refseq | NM_017737 |
Protein Refseq | NP_060207 |
MIM | 608848 |
UniProt ID | Q5T0N5 |
◆ Recombinant Proteins | ||
FNBP1L-2374R | Recombinant Rat FNBP1L Protein | +Inquiry |
FNBP1L-2030R | Recombinant Rat FNBP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
FNBP1L-4405H | Recombinant Human FNBP1L Protein, GST-tagged | +Inquiry |
FNBP1L-1057Z | Recombinant Zebrafish FNBP1L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNBP1L Products
Required fields are marked with *
My Review for All FNBP1L Products
Required fields are marked with *
0
Inquiry Basket