Recombinant Human FNDC1 Protein, GST-tagged
| Cat.No. : | FNDC1-4406H |
| Product Overview : | Human FNDC1 partial ORF ( XP_027658.3, 86 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FNDC1 (Fibronectin Type III Domain Containing 1) is a Protein Coding gene. Diseases associated with FNDC1 include Prostate Leiomyosarcoma. An important paralog of this gene is ABI3BP. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | VPSRLPPRSAATVSPVAGTHPWPQYTTRAPPGHFSTTPMLSLRQRMMHARFRNPLSRQPARPSYRQGYNGRPNVEGKVLPGSNGKPNGQRIINGPQGTK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FNDC1 fibronectin type III domain containing 1 [ Homo sapiens ] |
| Official Symbol | FNDC1 |
| Synonyms | AGS8; FNDC2; MEL4B3; bA243O10.1; dJ322A24.1; RP11-243O10.2 |
| Gene ID | 84624 |
| mRNA Refseq | NM_032532 |
| Protein Refseq | NP_115921 |
| MIM | 609991 |
| UniProt ID | Q4ZHG4 |
| ◆ Recombinant Proteins | ||
| FNDC1-4406H | Recombinant Human FNDC1 Protein, GST-tagged | +Inquiry |
| FNDC1-2375R | Recombinant Rat FNDC1 Protein | +Inquiry |
| FNDC1-2031R | Recombinant Rat FNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FNDC1-1673H | Recombinant Human FNDC1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC1 Products
Required fields are marked with *
My Review for All FNDC1 Products
Required fields are marked with *
