Recombinant Human FNDC5 protein

• Cat.No.: FNDC5-125H
• Product Overview: Recombinant human FNDC5 cDNA (15 - 127aa) protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 15-127 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHV QAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human brown fat cell differentiation regulation study.2. May be used for in vitro protein-protein interaction mapping.3. May be used as antigen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.

Gene Information

• Gene Name: FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
• Official Symbol: FNDC5
• Synonyms: FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2
• Gene ID: 252995
• mRNA Refseq: NM_001171940
• Protein Refseq: NP_001165411
• MIM: 611906
• UniProt ID: Q8NAU1
• Chromosome Location: 1p34.3
• Function: hormone activity