Recombinant Human FNDC5 protein

Cat.No. : FNDC5-125H
Product Overview : Recombinant human FNDC5 cDNA (15 - 127aa) protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 15-127 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHV QAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human brown fat cell differentiation regulation study.2. May be used for in vitro protein-protein interaction mapping.3. May be used as antigen for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.
Gene Name FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
Official Symbol FNDC5
Synonyms FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2;
Gene ID 252995
mRNA Refseq NM_001171940
Protein Refseq NP_001165411
MIM 611906
UniProt ID Q8NAU1
Chromosome Location 1p34.3
Function hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC5 Products

Required fields are marked with *

My Review for All FNDC5 Products

Required fields are marked with *

0
cart-icon