Recombinant Human FNDC5 protein
Cat.No. : | FNDC5-125H |
Product Overview : | Recombinant human FNDC5 cDNA (15 - 127aa) protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 15-127 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHV QAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human brown fat cell differentiation regulation study.2. May be used for in vitro protein-protein interaction mapping.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days. |
Gene Name | FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ] |
Official Symbol | FNDC5 |
Synonyms | FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2; |
Gene ID | 252995 |
mRNA Refseq | NM_001171940 |
Protein Refseq | NP_001165411 |
MIM | 611906 |
UniProt ID | Q8NAU1 |
Chromosome Location | 1p34.3 |
Function | hormone activity; |
◆ Recombinant Proteins | ||
FNDC5-4666H | Recombinant Human FNDC5 protein, His-SUMO-tagged | +Inquiry |
FNDC5-2840H | Recombinant Human FNDC5 Protein (Asp32-Glu143), N-His tagged | +Inquiry |
FNDC5-2376R | Recombinant Rat FNDC5 Protein | +Inquiry |
FNDC5-939H | Recombinant Human FNDC5 Protein, His&SUMO-tagged | +Inquiry |
FNDC5-2839H | Recombinant Human FNDC5 Protein (Asp32-Glu143), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC5 Products
Required fields are marked with *
My Review for All FNDC5 Products
Required fields are marked with *
0
Inquiry Basket