Recombinant Human FNDC5 protein, GST-tagged

Cat.No. : FNDC5-301596H
Product Overview : Recombinant Human FNDC5 (103-153 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ile103-Trp153
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
Official Symbol FNDC5
Synonyms FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2;
Gene ID 252995
mRNA Refseq NM_001171940
Protein Refseq NP_001165411
MIM 611906
UniProt ID Q8NAU1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC5 Products

Required fields are marked with *

My Review for All FNDC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon