Recombinant Human FNDC5 protein, GST-tagged
Cat.No. : | FNDC5-301596H |
Product Overview : | Recombinant Human FNDC5 (103-153 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile103-Trp153 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ] |
Official Symbol | FNDC5 |
Synonyms | FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2; |
Gene ID | 252995 |
mRNA Refseq | NM_001171940 |
Protein Refseq | NP_001165411 |
MIM | 611906 |
UniProt ID | Q8NAU1 |
◆ Recombinant Proteins | ||
FNDC5-08R | Recombinant Rat FNDC5 Protein, His/S-tagged | +Inquiry |
FNDC5-541H | Recombinant Human FNDC5 protein, His-tagged | +Inquiry |
FNDC5-008H | Recombinant Human FNDC5 Protein, His/SUMO-tagged | +Inquiry |
FNDC5-939H | Recombinant Human FNDC5 Protein, His&SUMO-tagged | +Inquiry |
FNDC5-2839H | Recombinant Human FNDC5 Protein (Asp32-Glu143), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC5 Products
Required fields are marked with *
My Review for All FNDC5 Products
Required fields are marked with *
0
Inquiry Basket