Recombinant Mouse FNDC5 protein, His-tagged

Cat.No. : FNDC5-10M
Product Overview : Recombinant Mouse FNDC5 protein is produced by E.coli expression system and the residues Leu74-Ile209 is expressed with a His tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : Leu74-Ile209
Molecular Mass : 18 kDa
AA Sequence : LRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVIMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 90 %
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Concentration : 200 μg/mL
Storage Buffer : 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300.
Reconstitution : Reconstitute in 20 mM Tris, 150 mM NaCl (pH 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name Fndc5 fibronectin type III domain containing 5 [ Mus musculus ]
Official Symbol FNDC5
Synonyms FRCP2; Irisin; FNDC5; PeP; Pxp; 1500001L03Rik;
Gene ID 70364

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC5 Products

Required fields are marked with *

My Review for All FNDC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon