Recombinant Human FNTA protein, GST-tagged

• Cat.No.: FNTA-3533H
• Product Overview: Recombinant Human FNTA protein(29-376 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 29-376 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: QQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FNTA farnesyltransferase, CAAX box, alpha [ Homo sapiens ]
• Official Symbol: FNTA
• Synonyms: FNTA; farnesyltransferase, CAAX box, alpha; protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; FPTA; PGGT1A; protein prenyltransferase alpha subunit repeat containing 2; PTAR2; FTase-alpha; GGTase-I-alpha; farnesyl-protein transferase alpha-subunit; ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; MGC99680
• Gene ID: 2339
• mRNA Refseq: NM_002027
• Protein Refseq: NP_002018
• MIM: 134635
• UniProt ID: P49354