Recombinant Human FNTA protein, GST-tagged
| Cat.No. : | FNTA-3533H |
| Product Overview : | Recombinant Human FNTA protein(29-376 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 29-376 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | QQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FNTA farnesyltransferase, CAAX box, alpha [ Homo sapiens ] |
| Official Symbol | FNTA |
| Synonyms | FNTA; farnesyltransferase, CAAX box, alpha; protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; FPTA; PGGT1A; protein prenyltransferase alpha subunit repeat containing 2; PTAR2; FTase-alpha; GGTase-I-alpha; farnesyl-protein transferase alpha-subunit; ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; MGC99680; |
| Gene ID | 2339 |
| mRNA Refseq | NM_002027 |
| Protein Refseq | NP_002018 |
| MIM | 134635 |
| UniProt ID | P49354 |
| ◆ Recombinant Proteins | ||
| FNTA-503H | Recombinant Human FNTA Protein, His-tagged | +Inquiry |
| FNTA-5061Z | Recombinant Zebrafish FNTA | +Inquiry |
| FNTA-2033R | Recombinant Rat FNTA Protein, His (Fc)-Avi-tagged | +Inquiry |
| FNTA-0471H | Recombinant Human FNTA Protein (M1-Q379), His/Strep tagged | +Inquiry |
| Fnta-725R | Recombinant Rat Fnta Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FNTA-661HCL | Recombinant Human FNTA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNTA Products
Required fields are marked with *
My Review for All FNTA Products
Required fields are marked with *
