Recombinant Human FOLH1 protein, His-tagged
Cat.No. : | FOLH1-744H |
Product Overview : | Recombinant Human FOLH1 protein(NP_001014986)(45-385 aa), fused to His tag, was expressed in E. coli. |
Availability | June 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 45-385 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | FOLH1 folate hydrolase (prostate-specific membrane antigen) 1 [ Homo sapiens ] |
Official Symbol | FOLH1 |
Synonyms | FOLH1; folate hydrolase (prostate-specific membrane antigen) 1; FOLH; glutamate carboxypeptidase 2; GCP2; GCPII; glutamate carboxylase II; glutamate carboxypeptidase II; NAALAD1; NAALAdase; PSM; PSMA; NAALADase I; membrane glutamate carboxypeptidase; cell growth-inhibiting gene 27 protein; folylpoly-gamma-glutamate carboxypeptidase; prostate specific membrane antigen variant F; pteroylpoly-gamma-glutamate carboxypeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; FGCP; mGCP; |
Gene ID | 2346 |
mRNA Refseq | NM_001014986 |
Protein Refseq | NP_001014986 |
MIM | 600934 |
UniProt ID | Q04609 |
◆ Recombinant Proteins | ||
FOLH1-4417H | Recombinant Human FOLH1 Protein, GST-tagged | +Inquiry |
FOLH1-931H | Recombinant Human FOLH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOLH1-784H | Recombinant Human FOLH1 protein, His-tagged | +Inquiry |
FOLH1-2379R | Recombinant Rat FOLH1 Protein | +Inquiry |
FOLH1-0534H | Recombinant Human FOLH1 Protein (Lys44-Ala750), N-TwinStrep-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLH1-2452MCL | Recombinant Mouse FOLH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLH1 Products
Required fields are marked with *
My Review for All FOLH1 Products
Required fields are marked with *
0
Inquiry Basket