Recombinant Human FOLH1 protein, His-tagged

Cat.No. : FOLH1-744H
Product Overview : Recombinant Human FOLH1 protein(NP_001014986)(45-385 aa), fused to His tag, was expressed in E. coli.
Availability December 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 45-385 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name FOLH1 folate hydrolase (prostate-specific membrane antigen) 1 [ Homo sapiens ]
Official Symbol FOLH1
Synonyms FOLH1; folate hydrolase (prostate-specific membrane antigen) 1; FOLH; glutamate carboxypeptidase 2; GCP2; GCPII; glutamate carboxylase II; glutamate carboxypeptidase II; NAALAD1; NAALAdase; PSM; PSMA; NAALADase I; membrane glutamate carboxypeptidase; cell growth-inhibiting gene 27 protein; folylpoly-gamma-glutamate carboxypeptidase; prostate specific membrane antigen variant F; pteroylpoly-gamma-glutamate carboxypeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; FGCP; mGCP;
Gene ID 2346
mRNA Refseq NM_001014986
Protein Refseq NP_001014986
MIM 600934
UniProt ID Q04609

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOLH1 Products

Required fields are marked with *

My Review for All FOLH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon