Recombinant Human FOLR2 Protein (19-230 aa), His-tagged

• Cat.No.: FOLR2-2815H
• Product Overview: Recombinant Human FOLR2 Protein (19-230 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 19-230 aa
• Description: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.1 kDa
• AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: FOLR2 folate receptor 2 (fetal) [ Homo sapiens ]
• Official Symbol: FOLR2
• Synonyms: FOLR2; folate receptor 2 (fetal); folate receptor beta; FBP; folate receptor, beta; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
• Gene ID: 2350
• mRNA Refseq: NM_000803
• Protein Refseq: NP_000794
• MIM: 136425
• UniProt ID: P14207