Recombinant Human FOLR2 Protein (19-230 aa), His-tagged
Cat.No. : | FOLR2-2815H |
Product Overview : | Recombinant Human FOLR2 Protein (19-230 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-230 aa |
Description : | Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.1 kDa |
AA Sequence : | CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | FOLR2 folate receptor 2 (fetal) [ Homo sapiens ] |
Official Symbol | FOLR2 |
Synonyms | FOLR2; folate receptor 2 (fetal); folate receptor beta; FBP; folate receptor, beta; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1; |
Gene ID | 2350 |
mRNA Refseq | NM_000803 |
Protein Refseq | NP_000794 |
MIM | 136425 |
UniProt ID | P14207 |
◆ Recombinant Proteins | ||
FOLR2-1559R | Recombinant Rhesus Macaque FOLR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOLR2-1435C | Active Recombinant Cynomolgus FOLR2 protein, His-tagged | +Inquiry |
FOLR2-1737R | Recombinant Rhesus monkey FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-2244H | Recombinant Human FOLR2 protein(Met1-His228), His-tagged | +Inquiry |
FOLR2-2815H | Recombinant Human FOLR2 Protein (19-230 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR2-2541HCL | Recombinant Human FOLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLR2 Products
Required fields are marked with *
My Review for All FOLR2 Products
Required fields are marked with *