Recombinant Human FOLR2 Protein (19-230 aa), His-tagged

Cat.No. : FOLR2-2815H
Product Overview : Recombinant Human FOLR2 Protein (19-230 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 19-230 aa
Description : Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.1 kDa
AA Sequence : CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name FOLR2 folate receptor 2 (fetal) [ Homo sapiens ]
Official Symbol FOLR2
Synonyms FOLR2; folate receptor 2 (fetal); folate receptor beta; FBP; folate receptor, beta; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1;
Gene ID 2350
mRNA Refseq NM_000803
Protein Refseq NP_000794
MIM 136425
UniProt ID P14207

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOLR2 Products

Required fields are marked with *

My Review for All FOLR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon