Active Recombinant Human FOLR2 Protein, His-tagged

Cat.No. : FOLR2-005H
Product Overview : Recombinant human FOLR2, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Folic Acid-BSA. The ED50 range ≤ 5 μg/mL.
Molecular Mass : 25.1 kDa
AA Sequence : QDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -84 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name FOLR2 folate receptor beta [ Homo sapiens (human) ]
Official Symbol FOLR2
Synonyms FOLR2; folate receptor beta; FBP; FOLR1; FR-P3; FRbeta; FR-BETA; BETA-HFR; FBP/PL-1; folate receptor beta; folate receptor 2 (fetal); folate receptor alpha; folate receptor, fetal/placental; folate-binding protein, fetal/placental; placental folate-binding protein
Gene ID 2350
mRNA Refseq NM_000803
Protein Refseq NP_000794.3
MIM 136425
UniProt ID P14207

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOLR2 Products

Required fields are marked with *

My Review for All FOLR2 Products

Required fields are marked with *

0
cart-icon