Active Recombinant Human FOLR2 Protein, His-tagged
Cat.No. : | FOLR2-005H |
Product Overview : | Recombinant human FOLR2, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Folic Acid-BSA. The ED50 range ≤ 5 μg/mL. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | QDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -84 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | FOLR2 folate receptor beta [ Homo sapiens (human) ] |
Official Symbol | FOLR2 |
Synonyms | FOLR2; folate receptor beta; FBP; FOLR1; FR-P3; FRbeta; FR-BETA; BETA-HFR; FBP/PL-1; folate receptor beta; folate receptor 2 (fetal); folate receptor alpha; folate receptor, fetal/placental; folate-binding protein, fetal/placental; placental folate-binding protein |
Gene ID | 2350 |
mRNA Refseq | NM_000803 |
Protein Refseq | NP_000794.3 |
MIM | 136425 |
UniProt ID | P14207 |
◆ Recombinant Proteins | ||
FOLR2-4420H | Recombinant Human FOLR2 Protein, GST-tagged | +Inquiry |
FOLR2-1559R | Recombinant Rhesus Macaque FOLR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOLR2-031H | Active Recombinant Human FOLR2 protein, His-tagged | +Inquiry |
FOLR2-1737R | Recombinant Rhesus monkey FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-1434H | Active Recombinant Human FOLR2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR2-2541HCL | Recombinant Human FOLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLR2 Products
Required fields are marked with *
My Review for All FOLR2 Products
Required fields are marked with *
0
Inquiry Basket