Active Recombinant Human FOLR2 Protein, His-tagged

• Cat.No.: FOLR2-005H
• Product Overview: Recombinant human FOLR2, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Folic Acid-BSA. The ED50 range ≤ 5 μg/mL.
• Molecular Mass: 25.1 kDa
• AA Sequence: QDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -84 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: FOLR2 folate receptor beta [ Homo sapiens (human) ]
• Official Symbol: FOLR2
• Synonyms: FOLR2; folate receptor beta; FBP; FOLR1; FR-P3; FRbeta; FR-BETA; BETA-HFR; FBP/PL-1; folate receptor beta; folate receptor 2 (fetal); folate receptor alpha; folate receptor, fetal/placental; folate-binding protein, fetal/placental; placental folate-binding protein
• Gene ID: 2350
• mRNA Refseq: NM_000803
• Protein Refseq: NP_000794.3
• MIM: 136425
• UniProt ID: P14207