Recombinant Human FOXC1 Protein, GST-tagged

Cat.No. : FOXC1-4437H
Product Overview : Human FOXC1 partial ORF ( NP_001444.1, 74 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXC1 forkhead box C1 [ Homo sapiens ]
Official Symbol FOXC1
Synonyms FOXC1; forkhead box C1; FKHL7, IRID1; forkhead box protein C1; ARA; FREAC3; IGDA; IHG1; myeloid factor-delta; forkhead-related activator 3; forkhead-related protein FKHL7; forkhead, drosophila, homolog-like 7; forkhead-related transcription factor 3; forkhead/winged helix-like transcription factor 7; FKHL7; IRID1; RIEG3; FREAC-3;
Gene ID 2296
mRNA Refseq NM_001453
Protein Refseq NP_001444
MIM 601090
UniProt ID Q12948

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXC1 Products

Required fields are marked with *

My Review for All FOXC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon