Recombinant Human FOXC1 Protein, GST-tagged
Cat.No. : | FOXC1-4437H |
Product Overview : | Human FOXC1 partial ORF ( NP_001444.1, 74 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXC1 forkhead box C1 [ Homo sapiens ] |
Official Symbol | FOXC1 |
Synonyms | FOXC1; forkhead box C1; FKHL7, IRID1; forkhead box protein C1; ARA; FREAC3; IGDA; IHG1; myeloid factor-delta; forkhead-related activator 3; forkhead-related protein FKHL7; forkhead, drosophila, homolog-like 7; forkhead-related transcription factor 3; forkhead/winged helix-like transcription factor 7; FKHL7; IRID1; RIEG3; FREAC-3; |
Gene ID | 2296 |
mRNA Refseq | NM_001453 |
Protein Refseq | NP_001444 |
MIM | 601090 |
UniProt ID | Q12948 |
◆ Recombinant Proteins | ||
Foxc1-7634M | Recombinant Mouse Foxc1 protein, His-tagged | +Inquiry |
FOXC1-5980M | Recombinant Mouse FOXC1 Protein | +Inquiry |
FOXC1-3317M | Recombinant Mouse FOXC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXC1-6564C | Recombinant Chicken FOXC1 | +Inquiry |
FOXC1-4437H | Recombinant Human FOXC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXC1-6161HCL | Recombinant Human FOXC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXC1 Products
Required fields are marked with *
My Review for All FOXC1 Products
Required fields are marked with *
0
Inquiry Basket