Recombinant Human FOXF2 Protein, GST-tagged
Cat.No. : | FOXF2-4450H |
Product Overview : | Human FOXF2 partial ORF (NP_001443.1, 346 a.a. - 443 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 346-443 a.a. |
Description : | FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXF2 forkhead box F2 [ Homo sapiens ] |
Official Symbol | FOXF2 |
Synonyms | FOXF2; forkhead box F2; FKHL6; forkhead box protein F2; FREAC2; FREAC-2; forkhead-like 6; forkhead-related activator 2; forkhead-related protein FKHL6; forkhead-related transcription factor 2; |
Gene ID | 2295 |
mRNA Refseq | NM_001452 |
Protein Refseq | NP_001443 |
MIM | 603250 |
UniProt ID | Q12947 |
◆ Recombinant Proteins | ||
FOXF2-4450H | Recombinant Human FOXF2 Protein, GST-tagged | +Inquiry |
Foxf2-1519M | Recombinant Mouse Foxf2 Protein, His-tagged | +Inquiry |
FOXF2-3323M | Recombinant Mouse FOXF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXF2-5989M | Recombinant Mouse FOXF2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXF2 Products
Required fields are marked with *
My Review for All FOXF2 Products
Required fields are marked with *