Recombinant Human FOXF2 Protein, GST-tagged

Cat.No. : FOXF2-4450H
Product Overview : Human FOXF2 partial ORF (NP_001443.1, 346 a.a. - 443 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 346-443 a.a.
Description : FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXF2 forkhead box F2 [ Homo sapiens ]
Official Symbol FOXF2
Synonyms FOXF2; forkhead box F2; FKHL6; forkhead box protein F2; FREAC2; FREAC-2; forkhead-like 6; forkhead-related activator 2; forkhead-related protein FKHL6; forkhead-related transcription factor 2;
Gene ID 2295
mRNA Refseq NM_001452
Protein Refseq NP_001443
MIM 603250
UniProt ID Q12947

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXF2 Products

Required fields are marked with *

My Review for All FOXF2 Products

Required fields are marked with *

0
cart-icon