Recombinant Human FOXI1 Protein, GST-tagged
Cat.No. : | FOXI1-4454H |
Product Overview : | Human FOXI1 full-length ORF ( NP_658982.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 57.20 kDa |
AA Sequence : | MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXI1 forkhead box I1 [ Homo sapiens ] |
Official Symbol | FOXI1 |
Synonyms | FOXI1; forkhead box I1; FKHL10; forkhead box protein I1; FREAC6; forkhead-like 10; HNF-3/fork-head homolog 3; HNF-3/fork-head homolog-3; forkhead-related activator 6; forkhead-related protein FKHL10; forkhead-related transcription factor 6; hepatocyte nuclear factor 3 forkhead homolog 3; HFH3; FKH10; HFH-3; FREAC-6; MGC34197; |
Gene ID | 2299 |
mRNA Refseq | NM_012188 |
Protein Refseq | NP_036320 |
MIM | 601093 |
UniProt ID | Q12951 |
◆ Recombinant Proteins | ||
FOXI1-4454H | Recombinant Human FOXI1 Protein, GST-tagged | +Inquiry |
Foxi1-1520M | Recombinant Mouse Foxi1 Protein, His-tagged | +Inquiry |
FOXI1-4576H | Recombinant Human FOXI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Foxi1-3072M | Recombinant Mouse Foxi1 Protein, Myc/DDK-tagged | +Inquiry |
FOXI1-2969H | Recombinant Human FOXI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXI1-6155HCL | Recombinant Human FOXI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXI1 Products
Required fields are marked with *
My Review for All FOXI1 Products
Required fields are marked with *
0
Inquiry Basket