Recombinant Human FOXI1 Protein, GST-tagged

Cat.No. : FOXI1-4454H
Product Overview : Human FOXI1 full-length ORF ( NP_658982.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 57.20 kDa
AA Sequence : MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXI1 forkhead box I1 [ Homo sapiens ]
Official Symbol FOXI1
Synonyms FOXI1; forkhead box I1; FKHL10; forkhead box protein I1; FREAC6; forkhead-like 10; HNF-3/fork-head homolog 3; HNF-3/fork-head homolog-3; forkhead-related activator 6; forkhead-related protein FKHL10; forkhead-related transcription factor 6; hepatocyte nuclear factor 3 forkhead homolog 3; HFH3; FKH10; HFH-3; FREAC-6; MGC34197;
Gene ID 2299
mRNA Refseq NM_012188
Protein Refseq NP_036320
MIM 601093
UniProt ID Q12951

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXI1 Products

Required fields are marked with *

My Review for All FOXI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon