Recombinant Human FOXI1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FOXI1-4576H
Product Overview : FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4.
Molecular Mass : 30.8 kDa
AA Sequence : MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FOXI1 forkhead box I1 [ Homo sapiens (human) ]
Official Symbol FOXI1
Synonyms FOXI1; forkhead box I1; FKHL10; forkhead box protein I1; FREAC6; forkhead-like 10; HNF-3/fork-head homolog 3; HNF-3/fork-head homolog-3; forkhead-related activator 6; forkhead-related protein FKHL10; forkhead-related transcription factor 6; hepatocyte nuclear factor 3 forkhead homolog 3; HFH3; FKH10; HFH-3; FREAC-6; MGC34197;
Gene ID 2299
mRNA Refseq NM_144769
Protein Refseq NP_658982
MIM 601093
UniProt ID Q12951

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXI1 Products

Required fields are marked with *

My Review for All FOXI1 Products

Required fields are marked with *

0
cart-icon