Recombinant Human FOXI2 Protein, GST-tagged
Cat.No. : | FOXI2-4455H |
Product Overview : | Human FOXI2 full-length ORF (BAC87649.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FOXI2 (Forkhead Box I2) is a Protein Coding gene. Diseases associated with FOXI2 include Mental Retardation-Hypotonic Facies Syndrome, X-Linked. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXI1. |
Molecular Mass : | 40 kDa |
AA Sequence : | MFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXI2 forkhead box I2 [ Homo sapiens ] |
Official Symbol | FOXI2 |
Synonyms | FOXI2; forkhead box I2; forkhead box protein I2; FLJ46831; homolog of mouse Foxi2; |
Gene ID | 399823 |
mRNA Refseq | NM_207426 |
Protein Refseq | NP_997309 |
MIM | 617202 |
UniProt ID | Q6ZQN5 |
◆ Recombinant Proteins | ||
FOXI2-4455H | Recombinant Human FOXI2 Protein, GST-tagged | +Inquiry |
FOXI2-5076HF | Recombinant Full Length Human FOXI2 Protein, GST-tagged | +Inquiry |
FOXI2-2559H | Recombinant Human FOXI2 Protein, MYC/DDK-tagged | +Inquiry |
FOXI2-1478H | Recombinant Human FOXI2 | +Inquiry |
Foxi2-3073M | Recombinant Mouse Foxi2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXI2 Products
Required fields are marked with *
My Review for All FOXI2 Products
Required fields are marked with *
0
Inquiry Basket