Recombinant Human FOXI2 Protein, GST-tagged

Cat.No. : FOXI2-4455H
Product Overview : Human FOXI2 full-length ORF (BAC87649.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FOXI2 (Forkhead Box I2) is a Protein Coding gene. Diseases associated with FOXI2 include Mental Retardation-Hypotonic Facies Syndrome, X-Linked. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXI1.
Molecular Mass : 40 kDa
AA Sequence : MFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXI2 forkhead box I2 [ Homo sapiens ]
Official Symbol FOXI2
Synonyms FOXI2; forkhead box I2; forkhead box protein I2; FLJ46831; homolog of mouse Foxi2;
Gene ID 399823
mRNA Refseq NM_207426
Protein Refseq NP_997309
MIM 617202
UniProt ID Q6ZQN5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXI2 Products

Required fields are marked with *

My Review for All FOXI2 Products

Required fields are marked with *

0
cart-icon