Recombinant Human FOXJ2 protein, His-tagged

Cat.No. : FOXJ2-3837H
Product Overview : Recombinant Human FOXJ2 protein(145-271 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability February 05, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 145-271 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : CPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name FOXJ2 forkhead box J2 [ Homo sapiens ]
Official Symbol FOXJ2
Synonyms FOXJ2; forkhead box J2; forkhead box protein J2; FHX; FOXJ2 forkhead factor; fork head homologous X;
Gene ID 55810
mRNA Refseq NM_018416
Protein Refseq NP_060886
UniProt ID Q9P0K8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXJ2 Products

Required fields are marked with *

My Review for All FOXJ2 Products

Required fields are marked with *

0
cart-icon
0
compare icon