Recombinant Human FOXR1 Protein, GST-tagged

Cat.No. : FOXR1-4479H
Product Overview : Human FOXR1 partial ORF ( NP_859072.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXR1 forkhead box R1 [ Homo sapiens ]
Official Symbol FOXR1
Synonyms FOXR1; forkhead box R1; forkhead box protein R1; DLNB13; FOXN5; forkhead box protein N5; forkhead box R1 variant 1; MGC149486;
Gene ID 283150
mRNA Refseq NM_181721
Protein Refseq NP_859072
MIM 615755
UniProt ID Q6PIV2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXR1 Products

Required fields are marked with *

My Review for All FOXR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon