Recombinant Human FPR1 protein
Cat.No. : | FPR1-263H |
Product Overview : | Recombinant Human FPR1 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
Official Symbol | FPR1 |
Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor; |
Gene ID | 2357 |
mRNA Refseq | NM_002029 |
Protein Refseq | NP_002020 |
MIM | 136537 |
UniProt ID | P21462 |
Chromosome Location | 19q13.41 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
Function | G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
FPR1-6022M | Recombinant Mouse FPR1 Protein | +Inquiry |
FPR1-2882H | Recombinant Human FPR1 Protein (Arg163-Val242), N-GST tagged | +Inquiry |
FPR1-263H | Recombinant Human FPR1 protein | +Inquiry |
FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
RFL17980PF | Recombinant Full Length Pongo Pygmaeus Fmet-Leu-Phe Receptor(Fpr1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *