"FPR1" Related Products

Expand

Recombinant Human FPR1 protein

Cat.No.: FPR1-263H
Product Overview: Recombinant Human FPR1 was expressed in Wheat Germ.
Description: This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
Source: Wheat Germ
Species: Human
Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass: 38.4 kDa
AA Sequence: METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Applications: Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: FPR1 formyl peptide receptor 1 [ Homo sapiens ]
Official Symbol: FPR1
Synonyms: FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor;
Gene ID: 2357
mRNA Refseq: NM_002029
Protein Refseq: NP_002020
MIM: 136537
UniProt ID: P21462
Chromosome Location: 19q13.41
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function: G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.