Recombinant Human FPR2 protein, GST-tagged

• Cat.No.: FPR2-3658H
• Product Overview: Recombinant Human FPR2 protein(300-350 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 300-350 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FPR2 formyl peptide receptor 2 [ Homo sapiens ]
• Official Symbol: FPR2
• Synonyms: FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II
• Gene ID: 2358
• mRNA Refseq: NM_001005738
• Protein Refseq: NP_001005738
• MIM: 136538
• UniProt ID: P25090