Recombinant Human FPR2 protein, His-tagged
| Cat.No. : | FPR2-3657H |
| Product Overview : | Recombinant Human FPR2 protein(300-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 300-350 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FPR2 formyl peptide receptor 2 [ Homo sapiens ] |
| Official Symbol | FPR2 |
| Synonyms | FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II; |
| Gene ID | 2358 |
| mRNA Refseq | NM_001005738 |
| Protein Refseq | NP_001005738 |
| MIM | 136538 |
| UniProt ID | P25090 |
| ◆ Recombinant Proteins | ||
| RFL6438PF | Recombinant Full Length Pongo Pygmaeus N-Formyl Peptide Receptor 2(Fpr2) Protein, His-Tagged | +Inquiry |
| FPR2-3658H | Recombinant Human FPR2 protein, GST-tagged | +Inquiry |
| FPR2-3657H | Recombinant Human FPR2 protein, His-tagged | +Inquiry |
| FPR2-2445M | Recombinant Mouse FPR2 Protein (1-29 aa), His-GST-Myc-tagged | +Inquiry |
| FPR2-12996H | Recombinant Human FPR2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FPR2-665HCL | Recombinant Human FPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR2 Products
Required fields are marked with *
My Review for All FPR2 Products
Required fields are marked with *
