Recombinant Human FPR2 Protein, GST-tagged

Cat.No. : FPR2-4487H
Product Overview : Human FPR2 partial ORF ( AAH29125.1, 163 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FPR2 (Formyl Peptide Receptor 2) is a Protein Coding gene. Diseases associated with FPR2 include Prion Disease. Among its related pathways are Peptide ligand-binding receptors and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR3.
Molecular Mass : 30.36 kDa
AA Sequence : FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol FPR2
Synonyms FPR2; formyl peptide receptor 2; formyl peptide receptor like 1, FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II;
Gene ID 2358
mRNA Refseq NM_001005738
Protein Refseq NP_001005738
MIM 136538
UniProt ID P25090

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FPR2 Products

Required fields are marked with *

My Review for All FPR2 Products

Required fields are marked with *

0
cart-icon