Recombinant Human FPR2 Protein, GST-tagged

• Cat.No.: FPR2-4487H
• Product Overview: Human FPR2 partial ORF ( AAH29125.1, 163 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FPR2 (Formyl Peptide Receptor 2) is a Protein Coding gene. Diseases associated with FPR2 include Prion Disease. Among its related pathways are Peptide ligand-binding receptors and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 30.36 kDa
• AA Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FPR2 formyl peptide receptor 2 [ Homo sapiens ]
• Official Symbol: FPR2
• Synonyms: FPR2; formyl peptide receptor 2; formyl peptide receptor like 1, FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II
• Gene ID: 2358
• mRNA Refseq: NM_001005738
• Protein Refseq: NP_001005738
• MIM: 136538
• UniProt ID: P25090