Recombinant Human FRMD8 Protein, GST-tagged
Cat.No. : | FRMD8-4205H |
Product Overview : | Human FKSG44 full-length ORF ( NP_114110.1, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FRMD8 (FERM Domain Containing 8) is a Protein Coding gene. An important paralog of this gene is KRIT1. |
Molecular Mass : | 77.6 kDa |
AA Sequence : | MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FRMD8 FERM domain containing 8 [ Homo sapiens ] |
Official Symbol | FRMD8 |
Synonyms | FRMD8; FERM domain containing 8; FERM domain-containing protein 8; FKSG44; FLJ90369; FLJ32216; MGC31785; |
Gene ID | 83786 |
mRNA Refseq | NM_031904 |
Protein Refseq | NP_114110 |
UniProt ID | Q9BZ67 |
◆ Recombinant Proteins | ||
FRMD8-4826HF | Recombinant Full Length Human FRMD8 Protein, GST-tagged | +Inquiry |
Frmd8-3085M | Recombinant Mouse Frmd8 Protein, Myc/DDK-tagged | +Inquiry |
FRMD8-1574R | Recombinant Rhesus Macaque FRMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRMD8-4205H | Recombinant Human FRMD8 Protein, GST-tagged | +Inquiry |
FRMD8-2049R | Recombinant Rat FRMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRMD8-6136HCL | Recombinant Human FRMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRMD8 Products
Required fields are marked with *
My Review for All FRMD8 Products
Required fields are marked with *
0
Inquiry Basket