Recombinant Human FRRS1L Protein, GST-tagged

Cat.No. : FRRS1L-5151H
Product Overview : Human C9orf4 partial ORF ( NP_055149, 158 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of the outer-core of an alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor protein in the brain. The encoded protein is thought to interact with inner-core components of the receptor, and play a role in the modulation of glutamate signaling. Mutations in this gene are associated with early infantile epileptic encephalopathy 37. [provided by RefSeq, Jul 2016]
Molecular Mass : 37.84 kDa
AA Sequence : FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FRRS1L ferric chelate reductase 1 like [ Homo sapiens (human) ]
Official Symbol FRRS1L
Synonyms C9orf4; FRRS1L; ferric chelate reductase 1 like; CG6; CG-6; C9orf4; EIEE37; DOMON domain-containing protein FRRS1L; brain protein CG-6
Gene ID 23732
mRNA Refseq NM_014334
Protein Refseq NP_055149
MIM 604574
UniProt ID Q9P0K9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FRRS1L Products

Required fields are marked with *

My Review for All FRRS1L Products

Required fields are marked with *

0
cart-icon