Recombinant Human FRRS1L Protein, GST-tagged
Cat.No. : | FRRS1L-5151H |
Product Overview : | Human C9orf4 partial ORF ( NP_055149, 158 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the outer-core of an alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor protein in the brain. The encoded protein is thought to interact with inner-core components of the receptor, and play a role in the modulation of glutamate signaling. Mutations in this gene are associated with early infantile epileptic encephalopathy 37. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FRRS1L ferric chelate reductase 1 like [ Homo sapiens (human) ] |
Official Symbol | FRRS1L |
Synonyms | C9orf4; FRRS1L; ferric chelate reductase 1 like; CG6; CG-6; C9orf4; EIEE37; DOMON domain-containing protein FRRS1L; brain protein CG-6 |
Gene ID | 23732 |
mRNA Refseq | NM_014334 |
Protein Refseq | NP_055149 |
MIM | 604574 |
UniProt ID | Q9P0K9 |
◆ Recombinant Proteins | ||
FRRS1L-5151H | Recombinant Human FRRS1L Protein, GST-tagged | +Inquiry |
RFL23190HF | Recombinant Full Length Human Uncharacterized Protein C9Orf4(C9Orf4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRRS1L Products
Required fields are marked with *
My Review for All FRRS1L Products
Required fields are marked with *
0
Inquiry Basket