Recombinant Human FSH/LH therapeutic protein(Menotropins)
| Cat.No. : | FSH&LH-P010H |
| Product Overview : | The protein contains follicle stimulating hormone (FSH) and luteinizing hormone (LH) purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunits, alpha = 92 residues, beta = 121 residues and?FSH?with 2 subunits, alpha = 92 residues, beta=111 residues. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Description : | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and a unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. The expression product is the active ingredient of Repronex. |
| Molecular Mass : | 23.4 Kda |
| AA Sequence : | >AlphaChain (LH)APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS>BetaChain (LH)SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL>BetaChain (FSH)NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE>AlphaChain (FSH)APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | FSH; Menotropins |
| ◆ Recombinant Proteins | ||
| FSH-01H | Recombinant Human FSH protein | +Inquiry |
| FSH-26H | Recombinant Human Follicle Stimulating Hormone Reference standard | +Inquiry |
| FSH-129H | Active Recombinant Human Follicle Stimulating Hormone protein | +Inquiry |
| FSH-5822A | Recombinant Chinese sturgeon FSH Protein (Met1-Asp128), C-Fc tagged | +Inquiry |
| FSH-0089H | Recombinant Human FSH Protein | +Inquiry |
| ◆ Native Proteins | ||
| FSH-35H | Native Human FSH | +Inquiry |
| FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
| FSH-186H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
| FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
| FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSH Products
Required fields are marked with *
My Review for All FSH Products
Required fields are marked with *
