Recombinant Human FSHR Protein, GST-tagged
Cat.No. : | FSHR-4522H |
Product Overview : | Human FSHR partial ORF ( NP_000136, 18 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | FSHR |
Synonyms | FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
Gene ID | 2492 |
mRNA Refseq | NM_000145 |
Protein Refseq | NP_000136 |
MIM | 136435 |
UniProt ID | P23945 |
◆ Recombinant Proteins | ||
FSHR-13016H | Recombinant Human FSHR, His-tagged | +Inquiry |
FSHR-4522H | Recombinant Human FSHR Protein, GST-tagged | +Inquiry |
FSHR-6636C | Recombinant Chicken FSHR | +Inquiry |
FSHR-24H-RPE | Recombinant Human FSHR Protein, His tagged, R-PE labeled | +Inquiry |
RFL13343CF | Recombinant Full Length Cairina Moschata Follicle-Stimulating Hormone Receptor(Fshr) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *