Recombinant Human FSHR Protein, GST-tagged

Cat.No. : FSHR-4522H
Product Overview : Human FSHR partial ORF ( NP_000136, 18 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Molecular Mass : 37.07 kDa
AA Sequence : CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FSHR follicle stimulating hormone receptor [ Homo sapiens ]
Official Symbol FSHR
Synonyms FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668;
Gene ID 2492
mRNA Refseq NM_000145
Protein Refseq NP_000136
MIM 136435
UniProt ID P23945

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSHR Products

Required fields are marked with *

My Review for All FSHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon